GLP-1 (7-36) [Cys(Sulfocyanine5)] HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-[Cys(Sulfocyanine5)]-amide



GLP-1 (7-36) [Cys(Sulfocyanine5)] 0.1mg

Datasheet download

GLP-1 (7-36) [Cys(Sulfocyanine5)] 0.5mg

Datasheet download
Secure payments
Please click here to download Material Safety Datasheet (MSDS)
Catalogue number crb1100802
Sequence (one letter code) HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-[Cys(Sulfocyanine5)]-amide
Sequence (three letter code) H-His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-[Cys(Sulfocyanine5)]-NH2
Purity >95%
Storage -20°C
Molecular Weight 4162.9